The domain within your query sequence starts at position 14 and ends at position 124; the E-value for the P-mevalo_kinase domain shown below is 1.4e-50.

FSGKRKSGKDFVTERLKSRLGGNICALLRLSGPLKEEYAREHGLDFQRLLDASTYKETYR
RDMICWGEQKRQADPGFFCRKIVEGVSQPIWLVSDTRRTSDIQWFQEAYGA

P-mevalo_kinase

P-mevalo_kinase
PFAM accession number:PF04275
Interpro abstract (IPR005919):

Phosphomevalonate kinase ( EC 2.7.4.2 ) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the higher eukaryotic form and the ERG8 type. This model represents the form of the enzyme found in animals.

GO process:cholesterol biosynthetic process (GO:0006695)
GO component:cytoplasm (GO:0005737)
GO function:phosphomevalonate kinase activity (GO:0004631)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P-mevalo_kinase