The domain within your query sequence starts at position 551 and ends at position 583; the E-value for the P68HR domain shown below is 5.2e-20.
SAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVAN
P68HR |
![]() |
---|
PFAM accession number: | PF08061 |
---|---|
Interpro abstract (IPR012587): | This short region is found in two copies in RNA helicase p68 (DDX5), which is involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner [ (PUBMED:21343338) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P68HR