The domain within your query sequence starts at position 53 and ends at position 150; the E-value for the PA domain shown below is 1.4e-14.
GLQGFLVEAHPENACGPIAPPPSAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVH NVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYLRA
PA |
![]() |
---|
PFAM accession number: | PF02225 |
---|---|
Interpro abstract (IPR003137): | The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [ (PUBMED:7674922) ]. The PA domain is also found in a plant vacuolar sorting receptor O22925 and members of the RZF family, e.g. O43567 . It has been suggested that this domain forms a lid-like structure that covers the active site in active proteases, and is involved in protein recognition in vacuolar sorting receptors [ (PUBMED:11246007) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PA