The domain within your query sequence starts at position 39 and ends at position 191; the E-value for the PAD_M domain shown below is 1.1e-57.
IEISLEADIYRDGQLDMPSDKQAKKKWMWGMNGWGAILLVNCSPNAVGQPDEQSFQEGPR EIQNLSQMNVTVEGPTSILQNYQLILHTSEEEAKKTRVYWSQRGSSAYELVVGPNKPVYL LPTFENRRKEAFYVEATEFPSPSFSGLISLSL
PAD_M |
![]() |
---|
PFAM accession number: | PF08527 |
---|---|
Interpro abstract (IPR013733): | Peptidylarginine deiminase (PAD) enzymes catalyze the conversion of protein-bound arginine to citrulline. There are five types of PADs known in humans, PAD1-PAD4 and PAD6 [ (PUBMED:14579251) ]. This entry represents the central non-catalytic domain of protein-arginine deiminase. This domain has an immunoglobulin-like fold [ (PUBMED:16567635) ]. |
GO process: | protein citrullination (GO:0018101) |
GO component: | cytoplasm (GO:0005737) |
GO function: | protein-arginine deiminase activity (GO:0004668), calcium ion binding (GO:0005509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAD_M