The domain within your query sequence starts at position 1 and ends at position 113; the E-value for the PAD_N domain shown below is 5.4e-39.

MASPRAVQLSLRKPTHAVCVVGVETLVNVYSDVPKGAKTFGVSGSSEVKIYMVYDPSRVA
EPAGWAHWPLDANVDVVVVADTVSKDLYDFKVKVSYFESQEAAALAHSVLYLT

PAD_N

PAD_N
PFAM accession number:PF08526
Interpro abstract (IPR013732):

This entry represents the N-terminal non-catalytic domain of protein-arginine deiminase. This domain has a cupredoxin-like fold.

GO component:cytoplasm (GO:0005737)
GO function:protein-arginine deiminase activity (GO:0004668), calcium ion binding (GO:0005509)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAD_N