The domain within your query sequence starts at position 78 and ends at position 215; the E-value for the PAE domain shown below is 1.2e-44.
KSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESKGSRRWLLFLEGGWYC FNRENCDSRYSTMRRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSG ASPKSDKNEYAFMGSLII
PAE |
![]() |
---|
PFAM accession number: | PF03283 |
---|---|
Interpro abstract (IPR004963): | This family includes protein Notum from animals and pectinacetylesterase (PAE) from plants. Notum is a carboxylesterase that removes an essential palmitoleate moiety from Wnt proteins. Notum constitutes the first known extracellular protein deacylase [ (PUBMED:25731175) (PUBMED:25771893) ]. PAEs catalyse the deacetylation of pectin, a major compound of primary cell walls [ (PUBMED:12026180) (PUBMED:25115560) ]. |
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAE