The domain within your query sequence starts at position 1 and ends at position 103; the E-value for the PAF-AH_p_II domain shown below is 2e-35.
MGAGQSVCFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCQASEKCEQPLWIPRYEYSMG LADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKAKESGYPLI
PAF-AH_p_II |
---|
PFAM accession number: | PF03403 |
---|---|
Interpro abstract (IPR005065): | Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipase A2, and is involved in regulation of inflammation through the inactivation of platelet-activating factor and polar phospholipids [ (PUBMED:9645224) ]. |
GO process: | lipid catabolic process (GO:0016042) |
GO function: | 1-alkyl-2-acetylglycerophosphocholine esterase activity (GO:0003847) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAF-AH_p_II