The domain within your query sequence starts at position 173 and ends at position 289; the E-value for the PALP domain shown below is 4.2e-19.
QALKPSVKVYAAEPSNADDCYQSKLKGELTPNLHPPETIADGVKSSIGLNTWPIIRDLVD DVFTVTEDEIKYATQLVWGRMKLLIEPTAGVALAAVLSQHFQTVSPEVKNVCIVLSG
PALP |
 |
|---|
| PFAM accession number: | PF00291 |
|---|---|
| Interpro abstract (IPR001926): | This entry represent a domain found in a group of proteins of the PLP-dependent enzymes superfamily represented by the beta subunit of tryptophan synthase [ (PUBMED:10673430) ]. It is a group of diverse proteins, including threonine dehydratase, cysteine synthase, pyridoxal phosphate-dependent deaminase, etc. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PALP