The domain within your query sequence starts at position 609 and ends at position 662; the E-value for the PAP_assoc domain shown below is 8.8e-15.
PLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKR
PAP_assoc |
![]() |
---|
PFAM accession number: | PF03828 |
---|---|
Interpro abstract (IPR002058): | This domain is found in poly(A) polymerases and has been shown to have polynucleotide adenylyltransferase activity [ (PUBMED:15607976) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAP_assoc