The domain within your query sequence starts at position 648 and ends at position 701; the E-value for the PAP_assoc domain shown below is 1.2e-13.

PLGQLWLELLKFYTLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKR

PAP_assoc

• PFAM accession number: PF03828
• Interpro abstract (IPR002058):

  This domain is found in poly(A) polymerases and has been shown to have polynucleotide adenylyltransferase activity [ (PUBMED:15607976) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAP_assoc