The domain within your query sequence starts at position 1 and ends at position 62; the E-value for the PAZ domain shown below is 4.1e-23.
QYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATA RS
PAZ |
 |
|---|
| PFAM accession number: | PF02170 |
|---|---|
| Interpro abstract (IPR003100): | This domain is named after the proteins Piwi Argonaut and Zwille. It is also found in the CAF protein from Arabidopsis thaliana. The function of the domain is unknown but has been found in the middle region of a number of members of the Argonaute protein family, which also contain the Piwi domain ( IPR003165 ) in their C-terminal region [ (PUBMED:12906857) ]. Several members of this family have been implicated in the development and maintenance of stem cells through the RNA-mediated gene-quelling mechanisms associated with the protein DICER. |
| GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAZ