The domain within your query sequence starts at position 651 and ends at position 685; the E-value for the PC_rep domain shown below is 1.1e-11.

GAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQ

PC_rep

PC_rep
PFAM accession number:PF01851
Interpro abstract (IPR002015):

A weakly conserved repeat module of unknown function, which occurs in two regulatory subunits of the 26S-proteasome and in one subunit of the anaphase-promoting complex [ (PUBMED:9204704) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC_rep