The domain within your query sequence starts at position 651 and ends at position 685; the E-value for the PC_rep domain shown below is 1.1e-11.
GAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQ
PC_rep |
---|
PFAM accession number: | PF01851 |
---|---|
Interpro abstract (IPR002015): | A weakly conserved repeat module of unknown function, which occurs in two regulatory subunits of the 26S-proteasome and in one subunit of the anaphase-promoting complex [ (PUBMED:9204704) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC_rep