The domain within your query sequence starts at position 103 and ends at position 179; the E-value for the PEX-1N domain shown below is 8.6e-27.

CQQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMP
AAPYGRLETNTKLLIQP

PEX-1N

PEX-1N
PFAM accession number:PF09262
Interpro abstract (IPR015342):

This domain adopts a double psi beta-barrel fold, similar in structure to the Cdc48 N-terminal domain. It has been suggested that this domain may be involved in interactions with ubiquitin, ubiquitin-like protein modifiers, or ubiquitin-like domains, such as Ubx. Furthermore, the domain may possess a putative adaptor or substrate binding site, allowing for peroxisomal biogenesis, membrane fusion and protein translocation [ (PUBMED:15328346) ].

GO process:peroxisome organization (GO:0007031)
GO component:peroxisome (GO:0005777)
GO function:ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEX-1N