The domain within your query sequence starts at position 104 and ends at position 179; the E-value for the PEX-1N domain shown below is 1.4e-27.
QQVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPA APYGRLETNTKLLIQP
PEX-1N |
---|
PFAM accession number: | PF09262 |
---|---|
Interpro abstract (IPR015342): | This domain adopts a double psi beta-barrel fold, similar in structure to the Cdc48 N-terminal domain. It has been suggested that this domain may be involved in interactions with ubiquitin, ubiquitin-like protein modifiers, or ubiquitin-like domains, such as Ubx. Furthermore, the domain may possess a putative adaptor or substrate binding site, allowing for peroxisomal biogenesis, membrane fusion and protein translocation [ (PUBMED:15328346) ]. |
GO process: | peroxisome organization (GO:0007031) |
GO component: | peroxisome (GO:0005777) |
GO function: | ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEX-1N