The domain within your query sequence starts at position 44 and ends at position 104; the E-value for the PG_binding_1 domain shown below is 5e-15.

RAEDLSLGVEWLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLAL
M

PG_binding_1

PG_binding_1
PFAM accession number:PF01471
Interpro abstract (IPR002477):

This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure. PGBD may have a general peptidoglycan binding function. It has a core structure consisting of a closed, three-helical bundle with a left-handed twist. It is found at the N or C terminus of a variety of enzymes involved in bacterial cell wall degradation [ (PUBMED:9555893) (PUBMED:7121588) (PUBMED:1683402) ]. Examples are:

  • Muramoyl-pentapeptide carboxypeptidase ( EC 3.4.17.8 )
  • N-acetylmuramoyl-L-alanine amidase cwlA precursor (cell wall hydrolase, autolysin, EC 3.5.1.28 )
  • Autolytic lysozyme (1,4-beta-N-acetylmuramidase, autolysin, EC 3.2.1.17 )
  • Membrane-bound lytic murein transglycosylase B
  • Zinc-containing D-alanyl-D-alanine-cleaving carboxypeptidase, VanX [ (PUBMED:6743245) ].

Many of the proteins having this domain are as yet uncharacterised. However, some are known to belong to MEROPS peptidase family M15 (clan MD), subfamily M15A metallopeptidases. A number of the proteins belonging to subfamily M15A are non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.

Eukaryotic enzymes can contain structurally similar PGBD-like domains. Matrix metalloproteinases (MMP), which catalyse extracellular matrix degradation, have N-terminal domains that resemble PGBD. Examples are gelatinase A (MMP-2), which degrades type IV collagen [ (PUBMED:10190290) ], stromelysin-1 (MMP-3), which plays a role in arthritis and tumour invasion [ (PUBMED:12810425) (PUBMED:12888258) ], and gelatinase B (MMP-9) secreted by neutrophils as part of the innate immune defence mechanism [ (PUBMED:12950257) ]. Several MMPs are implicated in cancer progression, since degradation of the extracellular matrix is an essential step in the cascade of metastasis [ (PUBMED:11956636) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PG_binding_1