The domain within your query sequence starts at position 511 and ends at position 553; the E-value for the PH_9 domain shown below is 4.5e-12.

YKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKG

PH_9

 PH_9
PFAM accession number:PF15410
Interpro abstract (IPR041681):

This pleckstrin homology domain belongs to a pfam clan whose members share a PH-like fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PH_9