The domain within your query sequence starts at position 153 and ends at position 248; the E-value for the PI31_Prot_C domain shown below is 1.4e-12.
SPPREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDP LRSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGP
PI31_Prot_C |
---|
PFAM accession number: | PF08577 |
---|---|
Interpro abstract (IPR013886): | This entry represents the C-terminal of the PI31 protein. PI31 is a cellular regulator of proteasome formation and of proteasome-mediated antigen processing [ (PUBMED:12374861) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PI31_Prot_C