SMART: Pfam domain PI3K

The domain within your query sequence starts at position 31 and ends at position 62; the E-value for the PI3K_p85B domain shown below is 1.9e-10.

YLNFPVSRNANLSTIKQVLWHRAQYEPLFHML

PI3K_p85B

PFAM accession number:	PF02192
Interpro abstract (IPR003113):	Phosphatidylinositol 3-kinases (PI3Ks) are lipid kinases that phosphorylate 4,5-bisphonate (PI(4,5) P2 or PIP2) at the 3-position of the inositol ring, and thus generate phosphatidylinositol 3,4,5-trisphosphate (PIP3), which, in turns, initiates a vast array of signaling events. PI3Ks can be grouped into three classes based on their domain organisation. Class I PI3Ks are heterodimers consisting of a p110 catalytic subunit and a regulatory subunit of either the p85 type (associated with the class IA p110 isoforms p110alpha, p110beta or p110delta) or the p101 type (associated with the class IB p110 isoform p110gamma). Common to all catalytic subunits are an N-terminal adaptor-binding domain (ABD) that binds to p85, a Ras-binding domain (RBD), a putative membrane-binding domain (C2), a helical domain of unknown function, and a kinase catalytic domain [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) ]. PI3K ABD is a small globular domain of about 100 residues in length with an alpha/beta-sandwich topology [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) ].

PFAM accession number:

PF02192

Interpro abstract (IPR003113):

Phosphatidylinositol 3-kinases (PI3Ks) are lipid kinases that phosphorylate 4,5-bisphonate (PI(4,5) P2 or PIP2) at the 3-position of the inositol ring, and thus generate phosphatidylinositol 3,4,5-trisphosphate (PIP3), which, in turns, initiates a vast array of signaling events. PI3Ks can be grouped into three classes based on their domain organisation. Class I PI3Ks are heterodimers consisting of a p110 catalytic subunit and a regulatory subunit of either the p85 type (associated with the class IA p110 isoforms p110alpha, p110beta or p110delta) or the p101 type (associated with the class IB p110 isoform p110gamma). Common to all catalytic subunits are an N-terminal adaptor-binding domain (ABD) that binds to p85, a Ras-binding domain (RBD), a putative membrane-binding domain (C2), a helical domain of unknown function, and a kinase catalytic domain [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) ].

PI3K ABD is a small globular domain of about 100 residues in length with an alpha/beta-sandwich topology [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PI3K_p85B