The domain within your query sequence starts at position 49 and ends at position 105; the E-value for the PIG-X domain shown below is 1.6e-14.
LKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPPGLFVDPYELASLRERNLTESFQ
PIG-X |
---|
PFAM accession number: | PF08320 |
---|---|
Interpro abstract (IPR013233): | Mammalian PIG-X and yeast PBN1 are essential components of glycosylphosphatidylinositol-mannosyltransferase I [ (PUBMED:15635094) ]. These enzymes are involved in the transfer of sugar molecules. They probably act by stabilizing the mannosyltransferase PIG-M (GPI14 in yeast) [ (PUBMED:15635094) (PUBMED:16418276) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIG-X