SMART: Pfam domain PIG-Y

The domain within your query sequence starts at position 4 and ends at position 70; the E-value for the PIG-Y domain shown below is 8.2e-25.

SLPTMTVLIPLVSLAGLLYSASVEEGFPEGCTSASSLCFYSLLLPVTVPVYVFFHLWTWM
GLKLFRH

PIG-Y

PFAM accession number:	PF15159
Interpro abstract (IPR029164):	This entry represents the subunit Y of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex found in the endoplasmic reticulum. The GPI-GnT complex catalyses the first step in the production of GPI (glycosylphosphatidylinositol)-anchors for cell surface proteins. PIG-Y may regulate activity of the complex by binding the catalytic subunit, PIG-A [ (PUBMED:16162815) ]. In the absence of PIG-Y activity, the cell surface levels of GPI-anchored proteins are severely decreased [ (PUBMED:16162815) ].

PFAM accession number:

PF15159

Interpro abstract (IPR029164):

This entry represents the subunit Y of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex found in the endoplasmic reticulum. The GPI-GnT complex catalyses the first step in the production of GPI (glycosylphosphatidylinositol)-anchors for cell surface proteins. PIG-Y may regulate activity of the complex by binding the catalytic subunit, PIG-A [ (PUBMED:16162815) ]. In the absence of PIG-Y activity, the cell surface levels of GPI-anchored proteins are severely decreased [ (PUBMED:16162815) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIG-Y