The domain within your query sequence starts at position 72 and ends at position 164; the E-value for the PIGA domain shown below is 1.9e-19.
HAYGNRKGVRYLTNGLKVYYLPLRVMYNQSTATTLFHSLPLLRVQLLGALEHKDVRNVLV QGHIFLNTSLTEAFCMAIVEAASCGLQVVSTKV
PIGA |
---|
PFAM accession number: | PF08288 |
---|---|
Interpro abstract (IPR013234): | This domain is found on phosphatidylinositol N-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with the disease paroxysmal nocturnal haemoglobinuria [ (PUBMED:12488505) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIGA