The domain within your query sequence starts at position 5 and ends at position 135; the E-value for the PIRT domain shown below is 8.3e-68.
PKALEVDERSPESKDLLPSQTASSLCISSRSESVWTTTPKSNWEIYHKPIIIMSVGAAIL LFGVAITCVAYILEEKHKVVQVLRMIGPAFLSLGLMMLVCGLVWVPIIKKKQKQRQKSNF FQSLKFFLLNR
PIRT |
---|
PFAM accession number: | PF15099 |
---|---|
Interpro abstract (IPR028068): | Phosphoinositide-Binding Protein (PIRT) is thought to have a role in positively regulating transient receptor potential vanilloid 1 (TRPV1) channel activity via phosphatidylinositol 4,5-bisphosphate (PIP2) [ (PUBMED:18455988) ]. TRPV1 is a molecular sensor of noxious heat and capsaicin. PIRT is predicted to be a multi-pass membrane protein and is located in the cell membrane [ (PUBMED:21224382) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIRT