The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the PITH domain shown below is 2.8e-17.
MGEDDDSHPSEMRLYKNIPQMSFDDTEREPEQTFSLNRDITGELEYATKISRFSNVYHLS IHISK
PITH |
---|
PFAM accession number: | PF06201 |
---|---|
Interpro abstract (IPR010400): | This entry represents the PITH domain (derived from Proteasome-Interacting THioredoxin). The protein Txnl1, which is a probable component of the 32kDa 26S proteasome, uses its C-terminal PITH domain to associate specifically with the 26S proteasome [ (PUBMED:19349277) ]. The PITH domain is dominated by a jelly roll beta-sandwich structure. The beta-sandwich is formed by face-to-face packing of two anti-parallel beta-sheets. Another two-stranded beta-sheet seals off one end of the beta-barrel [ (PUBMED:15741346) (PUBMED:20455272) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PITH