The domain within your query sequence starts at position 41 and ends at position 109; the E-value for the PKI domain shown below is 1.8e-31.
TDVESVITSFASSARAGRRNALPDIQSSLATSGSSDLPLKLEALAVKEDAKTKNEEKDQG QPKTPLNEG
PKI |
![]() |
---|
PFAM accession number: | PF02827 |
---|---|
Interpro abstract (IPR004171): | Members of this family are extremely potent competitive inhibitors of cAMP-dependent protein kinase activity. These proteins interact with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains. |
GO process: | negative regulation of protein kinase activity (GO:0006469) |
GO function: | cAMP-dependent protein kinase inhibitor activity (GO:0004862) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PKI