The domain within your query sequence starts at position 1 and ends at position 77; the E-value for the PLA2G12 domain shown below is 1.7e-36.
CSSYFLGIKVPGSMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRS LGFVSNVEALCSSPWKY
PLA2G12 |
![]() |
---|
PFAM accession number: | PF06951 |
---|---|
Interpro abstract (IPR010711): | This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) ( EC 3.1.1.4 ) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [ (PUBMED:11278438) ]. |
GO process: | lipid catabolic process (GO:0016042) |
GO component: | extracellular region (GO:0005576) |
GO function: | calcium ion binding (GO:0005509), phospholipase A2 activity (GO:0004623) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLA2G12