The domain within your query sequence starts at position 1003 and ends at position 1148; the E-value for the PLC-beta_C domain shown below is 8e-51.

QKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICE
KEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQE
KLVEKHNEIRQQILDEKPKGEGPSSV

PLC-beta_C

• PFAM accession number: PF08703
• Interpro abstract (IPR014815):

  This domain corresponds to the alpha helical C-terminal domain of phospholipase C beta (also known a 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta) [ (PUBMED:11753430) ].

• GO process: lipid catabolic process (GO:0016042)
• GO function: calcium ion binding (GO:0005509), phosphatidylinositol phospholipase C activity (GO:0004435)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLC-beta_C