The domain within your query sequence starts at position 1003 and ends at position 1176; the E-value for the PLC-beta_C domain shown below is 2.9e-61.
QKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICE KEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQE KLVEKHNEIRQQILDEKPKLQTELEQEYQDKFKRLPLEILEFVQEAMKGKISED
PLC-beta_C |
![]() |
---|
PFAM accession number: | PF08703 |
---|---|
Interpro abstract (IPR014815): | This domain corresponds to the alpha helical C-terminal domain of phospholipase C beta (also known a 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta) [ (PUBMED:11753430) ]. |
GO process: | lipid catabolic process (GO:0016042) |
GO function: | calcium ion binding (GO:0005509), phosphatidylinositol phospholipase C activity (GO:0004435) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLC-beta_C