The domain within your query sequence starts at position 741 and ends at position 811; the E-value for the PLU-1 domain shown below is 9.8e-16.
TWVNRVTEALSASFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCGSVAQL LLSKKQKHRIC
PLU-1 |
![]() |
---|
PFAM accession number: | PF08429 |
---|---|
Interpro abstract (IPR013637): | This domain is found in the central region of lysine-specific demethylases, which are nuclear proteins that may have a role in DNA-binding and transcription, and are associated with malignant cancer phenotypes [ (PUBMED:10336460) ]. The domain is also found in various other Jumonji/ARID domain-containing proteins (see IPR003347 IPR001606 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLU-1