The domain within your query sequence starts at position 1 and ends at position 37; the E-value for the PMAIP1 domain shown below is 3.6e-13.

MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCT

PMAIP1

PMAIP1
PFAM accession number:PF15150
Interpro abstract (IPR024140):

Phorbol-12-myristate-13-acetate-induced protein 1, also known as Noxa, is a p53 transcriptional target involved in the response to DNA-damaging agents [ (PUBMED:12952892) ]. Noxa can also be activated by other transcriptional factors, suggesting a broad role in the response to cellular stresses. It has been shown to promote activation of caspases and apoptosis [ (PUBMED:14699081) (PUBMED:20085765) ].

GO process:cellular response to DNA damage stimulus (GO:0006974), release of cytochrome c from mitochondria (GO:0001836), apoptotic process (GO:0006915), activation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0006919)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMAIP1