The domain within your query sequence starts at position 2 and ends at position 116; the E-value for the PMG domain shown below is 7.5e-11.
ADTCCTRTCVIAASTTSVCSSNLSCGNRICSPSTCLGASWQADNCQESYCEPPCCAPSCC QSSYCQPSCCAPAPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSP
PMG |
![]() |
---|
PFAM accession number: | PF05287 |
---|---|
Interpro abstract (IPR007951): | This entry represents the keratin-associated proteins, PMG type [ (PUBMED:10446281) ]. The major structural proteins of mammalian hair are the hair keratin intermediate filaments (KIFs) and the keratin-associated proteins (KRTAPs). In the hair cortex, hair keratins are embedded in an inter-filamentous matrix consisting of KRTAPs which are essential for the formation of a rigid and resistant hair shaft as a result of disulphide bonds between cysteine residues. There are essentially three groups of KRTAPs, viz: the high-sulphur (HS) and ultra-high-sulphur (UHS) KRTAPs (cysteine content: 16-30 and >30 mol%, respectively) and the high-glycine/tyrosine (HGT: 35-60 mol% glycine and tyrosine) KRTAPs. Other groups of keratin-associated proteins include IPR020184 and IPR021743 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMG