The domain within your query sequence starts at position 1 and ends at position 165; the E-value for the PMP22_Claudin domain shown below is 1.4e-60.

MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAF
EGYSVMQAVQATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASI
YTDRRQDLHQQNRKLYYLLQEGSYGYSFILAWVAFAFTFISGLMY

PMP22_Claudin

• PFAM accession number: PF00822
• Interpro abstract (IPR004031):

  This family of evolutionarily related integral membrane proteins includes PMP22, EMP, claudins and voltage-gated calcium channel gamma subunits, many of which which perform diverse functions at specialised cell-cell contacts [ (PUBMED:24665403) ]. Family members from vertebrates and invertebrates are highly divergent.

• GO component: integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMP22_Claudin