The domain within your query sequence starts at position 64 and ends at position 229; the E-value for the PMT_2 domain shown below is 3.2e-9.
SGPPFGHMLLALGGWLGGFDGNFLWNRIGAEYSSNVPIWSLRLLPALAGALSVPMAYQIV LELHFSHGAAIGAALLMLIENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFS VHWWLWLLLTGVSCSCAVGIKYMGIFTYLLVLGIAAVHAWNLIGDQ
PMT_2 |
---|
PFAM accession number: | PF13231 |
---|---|
Interpro abstract (IPR038731): | This entry represents a group of glycosyltransferases, including RgtA/B/C/D from Rhizobium leguminosarum bv. viciae. RgtA/B/C/D are involved in the modification of the lipopolysaccharide (LPS) inner core [ (PUBMED:16497674) (PUBMED:22110131) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMT_2