The domain within your query sequence starts at position 2 and ends at position 213; the E-value for the PNMA domain shown below is 4.5e-47.
ASILSRLGSSRGQNSPLPPWAHSMLRSLGRSLGPLMASMAERNMRLFSGRAEPAQGEETF ENWLSQVTGVLPDWHMPEEEKVRRLMRTLRGPAREVMRLLQAANPGLDVEDFLRAMKLVF GESESSVTAHSKFVNTVQEHGEKPSLYVIRLEVQLQNAIQAGVFAEREANQARLHQLLVG AEMSTDLRFRLKNLLRVYANEPERLPNFLELI
PNMA |
---|
PFAM accession number: | PF14893 |
---|---|
Interpro abstract (IPR026523): | The paraneoplastic Ma antigens (PNMA) have been identified using sera from patients with paraneoplastic neurological syndromes [ (PUBMED:16214224) ]. This family includes paraneoplastic antigen PNMA1 [ (PUBMED:10050892) ], PNMA2 [ (PUBMED:10362822) ], PNMA3 [ (PUBMED:11558790) ], PNMA4 (also known as modulator of apoptosis 1 or MOAP-1) [ (PUBMED:11060313) ] and some paraneoplastic antigen-like proteins (PNMA5 and PNMA6). The family also includes modulator of apoptosis 1, which has a role in death receptor-dependent apoptosis [ (PUBMED:15949439) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PNMA