The domain within your query sequence starts at position 179 and ends at position 257; the E-value for the POP1 domain shown below is 2.5e-23.
HKARRCHINRTLEFNRRQQKNIWLETHIWHAKRFHMVKKWGYCLGERPTAKSHRACYRAM TNLCLLQDLSYYCCLELKG
POP1 |
![]() |
---|
PFAM accession number: | PF06978 |
---|---|
Interpro abstract (IPR009723): | This entry represents a conserved region approximately 150 residues long located towards the N terminus of the POP1 subunit that is common to both the RNase MRP and RNase P ribonucleoproteins ( EC 3.1.26.5 ) [ (PUBMED:7926742) ]. These RNA-containing enzymes generate mature tRNA molecules by cleaving their 5' ends. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry POP1