SMART: Pfam domain PRAP

The domain within your query sequence starts at position 100 and ends at position 144; the E-value for the PRAP domain shown below is 1.1e-14.

PELDLDSIDHPMSDDVQDEEVPQSRPILYRQVLQGPEEDLDHLAH

PRAP

PFAM accession number:	PF15314
Interpro abstract (IPR027922):	PRAP, or proline-rich acidic protein 1, is a family of eukaryotic proteins. PRAP is abundantly expressed in the epithelial cells of the human liver, kidney, gastrointestinal tract, and cervix. It is significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues [ (PUBMED:24374861) ]. It is expressed in the epithelial cells of the mouse and rat gastrointestinal tracts, and pregnant mouse uterus. PRAP plays an important role in maintaining normal growth suppression [ (PUBMED:14583459) ].

PFAM accession number:

PF15314

Interpro abstract (IPR027922):

PRAP, or proline-rich acidic protein 1, is a family of eukaryotic proteins. PRAP is abundantly expressed in the epithelial cells of the human liver, kidney, gastrointestinal tract, and cervix. It is significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues [ (PUBMED:24374861) ]. It is expressed in the epithelial cells of the mouse and rat gastrointestinal tracts, and pregnant mouse uterus. PRAP plays an important role in maintaining normal growth suppression [ (PUBMED:14583459) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRAP