The domain within your query sequence starts at position 342 and ends at position 421; the E-value for the PRKCSH domain shown below is 2e-29.
SYCFHGGVGWWKYEFCYGKHVHQYHEDKDNGKTSVVVGTWNQEEHVEWAKKNTARAYHLQ DDGTQTVRMVSHFYGNGDIC
PRKCSH |
---|
PFAM accession number: | PF07915 |
---|---|
Interpro abstract (IPR012913): | This entry represents a domain found in the OS9 protein, which is a lectin that functions in endoplasmic reticulum (ER) quality control and ER-associated degradation (ERAD) [ (PUBMED:17932042) ]. The sequences of this domainare similar to a region found in the beta-subunit of glucosidase II ( P14314 ), which is also known as protein kinase C substrate 80K-H (PRKCSH). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKCSH