The domain within your query sequence starts at position 930 and ends at position 993; the E-value for the PRKG1_interact domain shown below is 4.5e-11.
DFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSQLEMEKRVAGKS QYLL
PRKG1_interact |
 |
|---|
| PFAM accession number: | PF15898 |
|---|---|
| Interpro abstract (IPR031775): | This domain is found at the C terminus of protein phosphatase 1 regulatory subunits 12A (PPP1R12A), 12B and 12C. In PPP1R12A it has been found to bind to cGMP-dependent protein kinase 1 via a leucine zipper motif located at the C terminus of this domain [ (PUBMED:12873707) (PUBMED:10567269) ]. |
| GO function: | protein kinase binding (GO:0019901) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKG1_interact