The domain within your query sequence starts at position 58 and ends at position 209; the E-value for the PRO8NT domain shown below is 1.6e-84.
KEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVP VLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLD YADNILDVEPLEAIQLELDPEEDAPVLDWFYD
PRO8NT |
---|
PFAM accession number: | PF08082 |
---|---|
Interpro abstract (IPR012591): | The PRO8NT domain is found at the N terminus of pre-mRNA splicing factors of PRO8 family [ (PUBMED:15112237) ]. The NLS or nuclear localisation signal for these spliceosome proteins begins at the start and runs for 60 residues. N-terminal to this domain is a highly variable proline-rich region [ (PUBMED:16431982) ]. |
GO process: | mRNA splicing, via spliceosome (GO:0000398) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRO8NT