The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the PRP1_N domain shown below is 6e-11.
MKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMD
PRP1_N |
![]() |
---|
PFAM accession number: | PF06424 |
---|---|
Interpro abstract (IPR010491): | This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N terminus of the RNA splicing factor encoded by prp1 [ (PUBMED:9003295) ]. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression. |
GO process: | mRNA splicing, via spliceosome (GO:0000398) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP1_N