The domain within your query sequence starts at position 13 and ends at position 169; the E-value for the PRP1_N domain shown below is 1.3e-62.

APLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDED
LNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYR
MERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNK

PRP1_N

PRP1_N
PFAM accession number:PF06424
Interpro abstract (IPR010491):

This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N terminus of the RNA splicing factor encoded by prp1 [ (PUBMED:9003295) ]. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression.

GO process:mRNA splicing, via spliceosome (GO:0000398)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP1_N