The domain within your query sequence starts at position 227 and ends at position 469; the E-value for the PRP21_like_P domain shown below is 7e-81.
SKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVD FQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDQEKAEETPSQLDQ DTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPD EYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQ LAE
PRP21_like_P |
![]() |
---|
PFAM accession number: | PF12230 |
---|---|
Interpro abstract (IPR022030): | This domain is found in eukaryotes, and is typically between 212 and 238 amino acids in length. It is found in association with . There are two completely conserved residues (W and H) that may be functionally important. It is found in the subunit 1 of mammalian splicing factor SF3A, which is involved in converting the U2 snRNP into its active form during pre-mRNA splicing [ (PUBMED:7489498) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP21_like_P