The domain within your query sequence starts at position 542 and ends at position 672; the E-value for the PRT_C domain shown below is 3.3e-10.
NRQRDTVVEDMLEDEEEEDDRDDKDGEKKGFINKIYAIQEVCVSVQNILDEVASLGERIK NTFNWTVPFLSWLAIVALCVFTAILYFIPLRYIVLVWGINKFTKKLRSPYAIDNNELLDF LSRVPSDVQVV
PRT_C |
![]() |
---|
PFAM accession number: | PF08372 |
---|---|
Interpro abstract (IPR013583): | This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains ( IPR000008 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRT_C