The domain within your query sequence starts at position 67 and ends at position 181; the E-value for the PTH2 domain shown below is 1.9e-51.
YKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEWEYCGQPKVVVKAPDED TLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY
PTH2 |
![]() |
---|
PFAM accession number: | PF01981 |
---|---|
Interpro abstract (IPR002833): | Peptidyl-tRNA hydrolases are enzymes that release tRNAs from peptidyl-tRNA during translation [ (PUBMED:12475929) ]. |
GO function: | aminoacyl-tRNA hydrolase activity (GO:0004045) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTH2