The domain within your query sequence starts at position 99 and ends at position 469; the E-value for the PTR2 domain shown below is 2.4e-105.
AFSSLCYFTPILGAAIADSWLGKFKILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAE ARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFGEDCYALAFGIPGLLMVLALVVFAMG SKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKA LTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDLGFFVLQPDQMQVLNPFLVLVFIPL FDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIKINGMIHPQPASQEIFLQV LNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNE YSVEEKNCYQL
PTR2 |
![]() |
---|
PFAM accession number: | PF00854 |
---|---|
Interpro abstract (IPR000109): | The proton-dependent oligopeptide transporter (POT) family (also known as the peptide transport (PTR) family) is made up of a group of energy-dependent transporters found in organisms as diverse as bacteria and humans. The POT family of proteins is distinct from the ABC-type peptide transporters and was uncovered by sequence analyses of peptide transport proteins [ (PUBMED:7476181) ]. They seem to be mainly involved in the intake of small peptides [ (PUBMED:7817396) ]. However, some family members are nitrate permeases and others are involved in histidine transport [ (PUBMED:17481610) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTR2