The domain within your query sequence starts at position 204 and ends at position 365; the E-value for the PUA_2 domain shown below is 2.7e-47.
IVPVDASYEVKELYVPENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMRE REYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFF EHRKEERCARQWGTTCKNHPYIKMVLEQGDWLIGGDLQVLDR
PUA_2 |
---|
PFAM accession number: | PF14306 |
---|---|
Interpro abstract (IPR025980): | This PUA-like domain is found at the N terminus of ATP-sulfurylase enzymes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUA_2