The domain within your query sequence starts at position 142 and ends at position 214; the E-value for the PUL domain shown below is 7.5e-14.
FPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQ QLQILWKAINWPE
PUL |
---|
PFAM accession number: | PF08324 |
---|---|
Interpro abstract (IPR013535): | The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes. It is found in association with either WD repeats and the PFU domain or PPPDE and thioredoxin domains. The PUL domain is a protein-protein interaction domain [ (PUBMED:15483401) (PUBMED:16428438) ]. Some proteins known to contain a PUL domain are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUL