The domain within your query sequence starts at position 535 and ends at position 789; the E-value for the PUL domain shown below is 1.4e-69.

FPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQ
QLQILWKAINWPEDIVFPALDILRLSIKHPNVNENFCNEKGDQFSSHLINLLNPKGKPAN
QLLALRTFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALATLTLNYSVCFHK
DHNIEGKAQCLSVISTILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQIKKY
VSVSEPAKVSECCRL

PUL

PUL
PFAM accession number:PF08324
Interpro abstract (IPR013535):

The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes. It is found in association with either WD repeats and the PFU domain or PPPDE and thioredoxin domains. The PUL domain is a protein-protein interaction domain [ (PUBMED:15483401) (PUBMED:16428438) ].

Some proteins known to contain a PUL domain are listed below:

  • Saccharomyces cerevisiae DOA1 (UFD3, ZZZ4), involved in ubiquitin conjugation pathway. DOA1 participates in the regulation of the ubiquitin conjugation pathway involving CDC48 by hindering multiubiquitination of substrates at the CDC48 chaperone.
  • Schizosaccharomyces pombe ubiquitin homeostasis protein lub1, acts as a negative regulator of vacuole-dependent ubiquitin degradation.
  • Mammalian phospholipase A-2-activating protein (PLA2P, PLAA), the homologue of DOA1. PLA2P plays an important role in the regulation of specific inflammatory disease processes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUL