SMART: Pfam domain PWI

The domain within your query sequence starts at position 7 and ends at position 77; the E-value for the PWI domain shown below is 1.5e-10.

DALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFVD
KLFESLYTKNY

PWI

PFAM accession number:	PF01480
Interpro abstract (IPR002483):	The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [ (PUBMED:10322432) ]. It is generally found in association with other domains such as RRM and RS. The PWI domain is a RNA/DNA-binding domain that has an equal preference for single- and double-stranded nucleic acids and is likely to have multiple important functions in pre-mRNA processing [ (PUBMED:12600940) ]. Proteins containing this domain include the SR-related nuclear matrix protein of 160kDa (SRm160) splicing and 3'-end cleavage-stimulatory factor, and the mammalian splicing factor PRP3. The PWI domain is a soluble, globular and independently folded domain which consists of a four-helix bundle, with structured N- and C-terminal elements [ (PUBMED:12600940) ].
GO process:	mRNA processing (GO:0006397)

PFAM accession number:

PF01480

Interpro abstract (IPR002483):

The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [ (PUBMED:10322432) ]. It is generally found in association with other domains such as RRM and RS. The PWI domain is a RNA/DNA-binding domain that has an equal preference for single- and double-stranded nucleic acids and is likely to have multiple important functions in pre-mRNA processing [ (PUBMED:12600940) ]. Proteins containing this domain include the SR-related nuclear matrix protein of 160kDa (SRm160) splicing and 3'-end cleavage-stimulatory factor, and the mammalian splicing factor PRP3.

The PWI domain is a soluble, globular and independently folded domain which consists of a four-helix bundle, with structured N- and C-terminal elements [ (PUBMED:12600940) ].

GO process:

mRNA processing (GO:0006397)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PWI