The domain within your query sequence starts at position 157 and ends at position 210; the E-value for the PXA domain shown below is 3.9e-13.
SSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLVRRIHK
PXA |
![]() |
---|
PFAM accession number: | PF02194 |
---|---|
Interpro abstract (IPR003114): | This domain is found associated with PX domains. The PX (phox) domain [ (PUBMED:8931154) ] occurs in a variety of eukaryotic proteins associated with intracellular signalling pathways. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PXA