The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the PXT1 domain shown below is 2.8e-34.
MQLRHIGDSVNHRVIQEHLAQEVGDVLAPFVALVFVRGQVLLRFFWNNHLL
PXT1 |
---|
PFAM accession number: | PF15214 |
---|---|
Interpro abstract (IPR029186): | This family of proteins is testis-specific [ (PUBMED:18160785) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PXT1